📦 Free Express Shipping on orders over $150 — Australia-wide
💎 Save up to 22%
Sale!

FOX04 10mg

Original price was: $699.00.Current price is: $526.90. inc. GST

✓ Verified BVR 98.36% Purity No Fillers Free Reship Guarantee
High-purity FOXO4-DRI (98.36% HPLC) — synthetic All-D-amino acid 46-mer retro-inverso peptide; sequence shown in single-letter D-AA notation (5358.06 Da, ESI-MS confirmed). Each 10mg vial includes a Batch Verification Report with HPLC data and mass spectrometry results, plus a batch-specific QR code for instant documentation access. Australian supplier with fast domestic shipping. If your order doesn’t arrive, we reship free. Research use only. –>

SKU: AV-R124 Category:
Analytical Reference Standard

FOXO4-DRI – 10mg

High-purity FOXO4-DRI analytical reference material — all-D-amino acid retro-inverso 46-mer, filler-free lyophilised powder

98.36%
HPLC PurityBVR verified
85.71%
Peptide ContentBVR verified
10mg
Per VialNominal content
0%
Fillers AddedNo mannitol or bulking
Batch Verification Report (BVR)Filler-FreeAustralian Laboratory Supply

Product Overview

Aventris Labs supplies research-grade FOXO4-DRI in a 5mg vial as an analytical reference standard. FOXO4-DRI is a synthetic all-D-amino acid retro-inverso 46-mer peptide designed to probe FOXO4-p53 protein-protein interactions in the context of senescent cell biology. The 46-residue sequence (C₂₂₈H₃₈₈N₈₆O₆₄, 5358.06 Da) uses exclusively D-amino acids, with D-allo-Ile as the stereospecific isoleucine substitution. ESI-MS confirmed mass: 5358.11 Da. Individual related substances ≤0.46% (specification ≤1.0%).

Primary applications: Reference standard for senescent cell biology, FOXO4-p53 pathway research, and all-D-amino acid peptide analytical work.

Documentation Included

  • Batch Verification Report (BVR) – Complete batch-specific analytical data
  • HPLC chromatography – 98.36% purity
  • Mass spectrometry (ESI-MS) – 5358.11 Da confirmed (±0.05 Da from theoretical)
  • Peptide content assay – 85.71% by nitrogen analysis
  • Related substances – Any individual impurity ≤0.46%
  • Karl Fischer water content – 4.09%
  • Acetate content – 11.82%
  • Mass Balance – Conforms
  • Batch verification portal – QR code and online lookup

Analytical Data (Batch Verification Report)

The following data represents this batch. Your batch-specific values are available in the Batch Verification Report (BVR) via the verification portal.

Parameter Result Specification Status
Purity (HPLC) 98.36% ≥98.0% PASS
Peptide Content (N%) 85.71% ≥75.0% PASS
Molecular Weight (ESI-MS) 5358.11 Da 5358.06 ±1.0 Da PASS
Water Content (Karl Fischer) 4.09% ≤10.0% PASS
Acetate Content (HPLC) 11.82% ≤12.0% PASS
Related Substances – Any Individual ≤0.46% ≤1.0% PASS
Mass Balance Conforms 95.0–105.0% PASS

Peptide Sequence

ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg
(all D-amino acids; D-allo-Ile used in place of D-Ile at Ile residues)

All-D-amino acid 46-mer retro-inverso peptide; sequence shown in single-letter D-AA notation

Ordering Information

📦

Package Contents

10mg FOXO4-DRI lyophilised powder in sealed glass vial with batch-specific labelling and QR verification code. No fillers, mannitol, or bulking agents added.

📄

Batch Verification Report

Complete BVR with HPLC purity, mass spectrometry, and analytical data accessible via QR code or online verification portal at aventrislabs.com/verify.

🚚

Australian Express Shipping

Fast domestic express shipping Australia-wide. If your order doesn’t arrive, we reship free — no questions asked.

💰

Tier Pricing Available

Volume discounts for research facilities and repeat orders. Contact for institutional pricing and bulk quantities.

Quality & Verification

Batch Verification Report (BVR)

Every batch includes comprehensive analytical documentation through Aventris Labs’ verification system, presenting all manufacturer analytical data in a standardised format.

🔬

Filler-Free Guarantee

Aventris peptides contain zero fillers. No mannitol, no bulking agents — just pure lyophilised peptide. The powder may appear smaller than competitors’ products because there’s nothing added.

🔗

Online Verification Portal

Instant batch verification via QR code or manual lookup. Access your batch-specific BVR anytime at aventrislabs.com/verify.

🇦🇺

Australian Laboratory Supply

Aventris Labs is an Australian supplier providing research-grade peptide reference materials to universities and biotech laboratories nationwide.

Complete Specifications

Product Name FOXO4-DRI
CAS Number N/A
Physical Form White to off-white lyophilised powder
Stereochemistry All-D-amino acids; D-allo-Ile at Ile positions
Sequence Length 46 amino acids (all D-configuration)
Molecular Formula C228H388N86O64
Molecular Weight 5358.06 Da (ESI-MS verified: 5358.11 Da)
Physical Form White to off-white lyophilised powder
Amount per Vial 10mg
Purity (HPLC) 98.36% (typical, ≥98.0% specification)
Peptide Content 85.71% (typical, ≥75.0% specification)
Water Content 4.09% (typical, ≤10.0% specification)
Storage Conditions Cool, dry place protected from light; -20°C for extended storage
Shelf Life 24 months when stored properly (retest date on BVR)
Intended Use Analytical Reference Standard / Research Use Only
Regulatory Status Not for human or veterinary use; laboratory research only

Frequently Asked Questions

Product Specifications

What is FOXO4-DRI?

FOXO4-DRI is a synthetic all-D-amino acid retro-inverso 46-mer peptide. The 46-residue sequence uses exclusively D-configured amino acids (with D-allo-Ile as the Ile stereoisomer), resulting in proteolytic stability. Molecular formula C₂₂₈H₃₈₈N₈₆O₆₄, MW 5358.06 Da. Supplied strictly as an analytical reference standard.

What does ‘all-D-amino acid retro-inverso’ mean?

A retro-inverso peptide uses D-amino acids in the reverse sequence order relative to the parent L-amino acid peptide. This creates a backbone that mimics the topochemical arrangement of the original peptide while providing resistance to proteolysis. D-allo-Ile is used in place of D-Ile as it is the naturally available D-isoleucine stereoisomer.

Why is FOXO4-DRI more expensive than other peptides?

FOXO4-DRI is a 46-residue all-D-amino acid peptide. The synthesis of long all-D-amino acid sequences is significantly more complex and costly than standard L-amino acid peptides, and D-amino acids themselves are considerably more expensive starting materials. The 5,358 Da molecular weight reflects a large, complex synthetic target.

Verification & Quality

How do I verify my batch?

Three methods: (1) Scan QR code on product label, (2) Click verification link in order confirmation email, (3) Visit aventrislabs.com/verify and enter batch ID. All provide instant access to your batch-specific Batch Verification Report.

Why does the powder look smaller than other suppliers?

Aventris peptides are filler-free. Many suppliers add mannitol or other bulking agents to make the powder appear larger. Our vials contain only pure lyophilised peptide — nothing else. Less visible powder means a purer product.

Regulatory & Compliance

What is the shelf life?

Typically 24 months when stored in sealed vial at -20°C or below, protected from light and moisture. Specific retest date is listed on the Batch Verification Report.

Does Aventris provide research protocols or application guidance?

No. Aventris supplies analytical reference materials only. We do not provide reconstitution protocols, application methods, dosing information, or research design guidance. For technical science questions, resources such as Grok AI can assist with research-level inquiries.

Regulatory Disclaimer – Analytical Reference Material

⚠️

FOXO4-DRI is supplied as an analytical reference standard for research use only.

NOT for:

  • Human consumption, administration, or therapeutic use
  • Veterinary or animal health applications
  • Diagnostic procedures
  • Clinical trials involving human subjects (without appropriate approvals)
  • Food, cosmetic, or dietary supplement applications
  • Personal or consumer use of any kind

Purchaser Responsibilities:

  • Verify compliance with all applicable federal, state, and local regulations
  • Maintain proper laboratory safety and handling procedures
  • Ensure appropriate storage, documentation, and chain of custody
  • Use only for legitimate analytical/research purposes as intended

Aventris Labs Does NOT Provide:

  • Medical, therapeutic, or health-related advice
  • Dosing recommendations or administration protocols
  • Reconstitution instructions or methods
  • Research design or experimental methodologies

Order FOXO4-DRI 10mg Analytical Reference Material

High-purity FOXO4-DRI in a 10mg vial. Every order includes complete Batch Verification Report (BVR), batch verification portal access, filler-free guarantee, and Australian domestic express shipping with free reship guarantee.

98.36% HPLC Purity
Complete BVR Included
Filler-Free
Free Reship Guarantee

Scroll to Top