📦 Free Express Shipping on orders over $150 — Australia-wide
💎 Save up to 22%
Sale!

LL-37 5mg

Original price was: $229.00.Current price is: $207.90. inc. GST

✓ Verified BVR 99.53% Purity No Fillers Free Reship Guarantee
High-purity LL-37 (Cathelicidin) (99.53% HPLC) — synthetic 37 amino acids (single-letter notation) (4493.74 Da, ESI-MS confirmed). Each 5mg vial includes a Batch Verification Report with HPLC data and mass spectrometry results, plus a batch-specific QR code for instant documentation access. Australian supplier with fast domestic shipping. If your order doesn’t arrive, we reship free. Research use only. –>

SKU: AV-R117 Category:
Analytical Reference Standard

LL-37 (Cathelicidin) – 5mg

High-purity LL-37 (human cathelicidin) analytical reference material — synthetic 37-amino acid cationic α-helical peptide, filler-free lyophilised powder

99.53%
HPLC PurityBVR verified
89.04%
Peptide ContentBVR verified
5mg
Per VialNominal content
0%
Fillers AddedNo mannitol or bulking
Batch Verification Report (BVR)Filler-FreeAustralian Laboratory SupplyCAS 154947-66-7

Product Overview

Aventris Labs supplies research-grade LL-37 in a 10mg vial (CAS 154947-66-7) as an analytical reference standard. LL-37 is the C-terminal cleavage product of human hCAP18, a 37-amino acid cationic α-helical peptide (C₂₀₅H₃₄₀N₆₀O₅₃, 4493.74 Da). Manufactured by solid-phase peptide synthesis (SPPS) with 99.53% HPLC purity and comprehensive mass spectrometry confirmation.

Primary applications: Reference standard for cathelicidin peptide research, peptide-lipid interaction studies, and analytical method development.

Documentation Included

  • Batch Verification Report (BVR) – Complete batch-specific analytical data
  • HPLC chromatography – 99.53% purity
  • Mass spectrometry (ESI-MS) – Molecular weight confirmation
  • Peptide content assay – 89.04% by nitrogen analysis
  • Karl Fischer water content – 3.28%
  • Acetate content – 7.06%
  • Mass Balance – 99.38%
  • Batch verification portal – QR code and online lookup

Analytical Data (Batch Verification Report)

The following data represents this batch. Your batch-specific values are available in the Batch Verification Report (BVR) via the verification portal.

Parameter Result Specification Status
Purity (HPLC) 99.53% ≥98.0% PASS
Peptide Content (N%) 89.04% ≥75.0% PASS
Molecular Weight (ESI-MS) Conforms 4493.74 ±1.0 Da PASS
Water Content (Karl Fischer) 3.28% ≤10.0% PASS
Acetate Content (HPLC) 7.06% <15.0% PASS
Mass Balance 99.38% 95.0–105.0% PASS

Peptide Sequence

[LL-37, 37 aa]

37 amino acids (single-letter notation)

Ordering Information

📦

Package Contents

5mg LL-37 (Cathelicidin) lyophilised powder in sealed glass vial with batch-specific labelling and QR verification code. No fillers, mannitol, or bulking agents added.

📄

Batch Verification Report

Complete BVR with HPLC purity, mass spectrometry, and analytical data accessible via QR code or online verification portal at aventrislabs.com/verify.

🚚

Australian Express Shipping

Fast domestic express shipping Australia-wide. If your order doesn’t arrive, we reship free — no questions asked.

💰

Tier Pricing Available

Volume discounts for research facilities and repeat orders. Contact for institutional pricing and bulk quantities.

Quality & Verification

Batch Verification Report (BVR)

Every batch includes comprehensive analytical documentation through Aventris Labs’ verification system, presenting all manufacturer analytical data in a standardised format.

🔬

Filler-Free Guarantee

Aventris peptides contain zero fillers. No mannitol, no bulking agents — just pure lyophilised peptide. The powder may appear smaller than competitors’ products because there’s nothing added.

🔗

Online Verification Portal

Instant batch verification via QR code or manual lookup. Access your batch-specific BVR anytime at aventrislabs.com/verify.

🇦🇺

Australian Laboratory Supply

Aventris Labs is an Australian supplier providing research-grade peptide reference materials to universities and biotech laboratories nationwide.

Complete Specifications

Product Name LL-37 (Cathelicidin)
CAS Number 154947-66-7
Physical Form White lyophilised powder
Sequence Length 37 amino acids
Molecular Formula C205H340N60O53
Molecular Weight 4493.74 Da (ESI-MS verified: Conforms)
Physical Form White to off-white lyophilised powder
Amount per Vial 5mg
Purity (HPLC) 99.53% (typical, ≥98.0% specification)
Peptide Content 89.04% (typical, ≥75.0% specification)
Water Content 3.28% (typical, ≤10.0% specification)
Storage Conditions Cool, dry place protected from light; -20°C for extended storage
Shelf Life 24 months when stored properly (retest date on BVR)
Intended Use Analytical Reference Standard / Research Use Only
Regulatory Status Not for human or veterinary use; laboratory research only

Frequently Asked Questions

Product Specifications

What is LL-37?

LL-37 (CAS 154947-66-7) is a synthetic 37-amino acid cationic α-helical peptide with molecular formula C₂₀₅H₃₄₀N₆₀O₅₃ and molecular weight 4493.74 Da. It represents the C-terminal active fragment of the human cathelicidin precursor hCAP18. Supplied strictly as an analytical reference standard for laboratory research.

What purity does this batch achieve?

This batch achieves 99.53% HPLC purity (specification ≥98.0%) and 89.04% peptide content by nitrogen analysis (specification ≥75.0%), with mass balance of 99.38%.

Verification & Quality

How do I verify my batch?

Three methods: (1) Scan QR code on product label, (2) Click verification link in order confirmation email, (3) Visit aventrislabs.com/verify and enter batch ID. All provide instant access to your batch-specific Batch Verification Report.

Why does the powder look smaller than other suppliers?

Aventris peptides are filler-free. Many suppliers add mannitol or other bulking agents to make the powder appear larger. Our vials contain only pure lyophilised peptide — nothing else. Less visible powder means a purer product.

Regulatory & Compliance

What is the shelf life?

Typically 24 months when stored in sealed vial at -20°C or below, protected from light and moisture. Specific retest date is listed on the Batch Verification Report.

Does Aventris provide research protocols or application guidance?

No. Aventris supplies analytical reference materials only. We do not provide reconstitution protocols, application methods, dosing information, or research design guidance. For technical science questions, resources such as Grok AI can assist with research-level inquiries.

Regulatory Disclaimer – Analytical Reference Material

⚠️

LL-37 (Cathelicidin) is supplied as an analytical reference standard for research use only.

NOT for:

  • Human consumption, administration, or therapeutic use
  • Veterinary or animal health applications
  • Diagnostic procedures
  • Clinical trials involving human subjects (without appropriate approvals)
  • Food, cosmetic, or dietary supplement applications
  • Personal or consumer use of any kind

Purchaser Responsibilities:

  • Verify compliance with all applicable federal, state, and local regulations
  • Maintain proper laboratory safety and handling procedures
  • Ensure appropriate storage, documentation, and chain of custody
  • Use only for legitimate analytical/research purposes as intended

Aventris Labs Does NOT Provide:

  • Medical, therapeutic, or health-related advice
  • Dosing recommendations or administration protocols
  • Reconstitution instructions or methods
  • Research design or experimental methodologies

Order LL-37 (Cathelicidin) 5mg Analytical Reference Material

High-purity LL-37 (Cathelicidin) in a 5mg vial. Every order includes complete Batch Verification Report (BVR), batch verification portal access, filler-free guarantee, and Australian domestic express shipping with free reship guarantee.

99.53% HPLC Purity
Complete BVR Included
Filler-Free
Free Reship Guarantee

Scroll to Top